PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04723A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 229aa    MW: 26289 Da    PI: 9.1209
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04723AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.31e-145599348
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +WT+eEd +l ++ k+ G ++W+++a+ m+ gR++  c+ rw+++l
  Oropetium_20150105_04723A 55 AWTAEEDARLERLAKENGFRHWHRVASQMP-GRSPSLCRYRWRDHL 99
                               7*****************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.34649103IPR017930Myb domain
SMARTSM007171.2E-1152101IPR001005SANT/Myb domain
SuperFamilySSF466896.84E-1754130IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-1655116IPR009057Homeodomain-like
CDDcd001678.98E-125599No hitNo description
PfamPF002491.2E-135599IPR001005SANT/Myb domain
SMARTSM0071725104154IPR001005SANT/Myb domain
PROSITE profilePS500906.284107152IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MDFGKRMGDK LEEKRRTIEE KGRNIVEKMR ENARTNSMER TGSSQCIARI SLPRAWTAEE  60
DARLERLAKE NGFRHWHRVA SQMPGRSPSL CRYRWRDHLA RHVYHRPFTA GDDKELQRLV  120
ARFGTSGRWK DIGRAXXXXX XXXXXXRWRE LRRKNRRGGG KIYYCQPALP SDEDDHEQGM  180
ELDEALQQDR CCVDDVLASG FASCSLAIED AVDPRAGSLA LGFACMAV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645964.18e-52PREDICTED: myb-related protein B-like
TrEMBLI1QTP16e-54I1QTP1_ORYGL; Uncharacterized protein
STRINGORGLA10G0057400.12e-53(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125692035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-15myb domain protein r1